TEFM Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TEFM Antibody is: synthetic peptide directed towards the N-terminal region of Human TEFM. Synthetic peptide located within the following region: NLESLMNVPLFKYKSTVQVCNSILCPKTGREKRKSPENRFLRKLLKPDIE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	transcription elongation factor, mitochondrial
Database Link	NP_078959 Entrez Gene 79736 Human UniProt ID Q96QE5
Background	TEFM is a transcription elongation factor which increases mitochondrial RNA polymerase processivity. It regulates transcription of the mitochondrial genome, including genes important for the oxidative phosphorylation machinery.
Synonyms	C17orf42
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.