ABCG5 Rabbit Polyclonal Antibody

CAT#: TA331771

Rabbit Polyclonal Anti-ABCG5 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5200.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-ABCG5 Antibody: synthetic peptide directed towards the middle region of human ABCG5. Synthetic peptide located within the following region: CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 72 kDa
Gene Name ATP binding cassette subfamily G member 5
Background The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. The protein encoded by this gene functions as a half-transporter to limit intestinal absorption and promote biliary excretion of sterols. It is expressed in a tissue-specific manner in the liver, colon, and intestine. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG8. Mutations in this gene may contribute to sterol accumulation and atheroschlerosis, and have been observed in patients with sitosterolemia.
Synonyms STSL
Note Immunogen sequence homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Horse: 93%; Dog: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways ABC transporters
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...