RAB18 Rabbit Polyclonal Antibody
CAT#: TA331791
Rabbit Polyclonal Anti-RAB18 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-RAB18 Antibody: synthetic peptide directed towards the C terminal of human RAB18. Synthetic peptide located within the following region: LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 23 kDa |
Gene Name | RAB18, member RAS oncogene family |
Database Link | |
Background | RAB18 belongs to the small GTPase superfamily.The protein plays a role in apical endocytosis/recycling and may be implicated in transport between the plasma membrane and early endosomes |
Synonyms | RAB18LI1; WARBM3 |
Note | Immunogen sequence homology: Horse: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Goat: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |