ZNF624 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF624 Antibody: synthetic peptide directed towards the middle region of human ZNF624. Synthetic peptide located within the following region: PYECNECGKAFNRIANFTEHQRIHTGEKPYKCNECGKAFINYSCLTVHHR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	100 kDa
Gene Name	zinc finger protein 624
Database Link	NP_065838 Entrez Gene 57547 Human UniProt ID Q9P2J8
Background	This gene, located on chromosome 17, encodes a protein that is part of the zinc finger family.
Synonyms	KIAA1349; MGC119602; MGC119603; MGC119605
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 90%; Guinea pig: 82%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.