REXO4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-REXO4 Antibody: synthetic peptide directed towards the C terminal of human REXO4. Synthetic peptide located within the following region: QYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQGEELEVVQKEVAEMLK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	REX4 homolog, 3'-5' exonuclease
Database Link	NP_065118 Entrez Gene 57109 Human UniProt ID Q9GZR2
Background	The regulation of the quinone reductase (QR) gene as well as other genes involved in detoxification is known to be mediated by an electrophile response element (EpRE). QR gene regulation by the antiestrogen-occupied estrogen receptor (ER) is mediated by the EpRE-containing region of the human QR gene, and the ER is one of the complex of proteins that binds to the EpRE. REXO4 directly binds to the EpRE and interacts with the ER. The activation of QR gene activity by REXO4 is enhanced in the presence of ER beta.
Synonyms	REX4; XPMC2; XPMC2H
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Horse: 92%; Zebrafish: 79%; Guinea pig: 79%; Bovine: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.