BBX Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-BBX Antibody: synthetic peptide directed towards the middle region of human BBX. Synthetic peptide located within the following region: KKTGNVSSEPTKTSKGSGDKWSNKQLFLDAIHPTEAIFSEDRNTMEPVHK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	101 kDa
Gene Name	bobby sox homolog (Drosophila)
Database Link	NP_064620 Entrez Gene 56987 Human UniProt ID Q8WY36
Background	BBX is a transcription factor that is necessary for cell cycle progression from G1 to S phase.
Synonyms	ARTC1; HBP2; HSPC339; MDS001
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Mouse: 86%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.