CASZ1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CASZ1 Antibody: synthetic peptide directed towards the middle region of human CASZ1. Synthetic peptide located within the following region: TPARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	125 kDa
Gene Name	castor zinc finger 1
Database Link	NP_060236 Entrez Gene 69743 MouseEntrez Gene 54897 Human UniProt ID Q86V15
Background	CASZ1 contains 8 C2H2-type zinc fingers.It is expressed in a number of human tumors and localizes to a chromosomal region frequently lost in tumors of neuroectodermal origin.
Synonyms	CAS11; CST; dJ734G22.1; SRG; ZNF693
Note	Immunogen sequence homology: Human: 100%; Bovine: 93%; Pig: 79%; Horse: 79%; Guinea pig: 79%; Rat: 77%; Mouse: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.