CASZ1 Rabbit Polyclonal Antibody
CAT#: TA331883
Rabbit Polyclonal Anti-CASZ1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human, Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-CASZ1 Antibody: synthetic peptide directed towards the middle region of human CASZ1. Synthetic peptide located within the following region: TPARFPPAQVKPEPGESTGAPGPHEASQDRSLDLTVKEPSNESNGHAVPA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 125 kDa |
Gene Name | castor zinc finger 1 |
Database Link | |
Background | CASZ1 contains 8 C2H2-type zinc fingers.It is expressed in a number of human tumors and localizes to a chromosomal region frequently lost in tumors of neuroectodermal origin. |
Synonyms | CAS11; CST; dJ734G22.1; SRG; ZNF693 |
Note | Immunogen sequence homology: Human: 100%; Bovine: 93%; Pig: 79%; Horse: 79%; Guinea pig: 79%; Rat: 77%; Mouse: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |