HSPA14 Rabbit Polyclonal Antibody
CAT#: TA331917
Rabbit Polyclonal Anti-HSPA14 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-HSPA14 Antibody is: synthetic peptide directed towards the N-terminal region of Human HSPA14. Synthetic peptide located within the following region: AVVAYSENEEIVGLAAKQSRIRNISNTVMKVKQILGRSSSDPQAQKYIAE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 56 kDa |
Gene Name | heat shock protein family A (Hsp70) member 14 |
Database Link | |
Background | HSPA14 is a component of the ribosome-associated complex (RAC), a complex involved in folding or maintaining nascent polypeptides in a folding-competent state. In the RAC complex, It binds to the nascent polypeptide chain, while DNAJC2 stimulates its ATPase activity. |
Synonyms | HSP70-4; HSP70L1 |
Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 79% |
Reference Data | |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |