TELO2 Rabbit Polyclonal Antibody
CAT#: TA331928
Rabbit Polyclonal Anti-TELO2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TELO2 Antibody is: synthetic peptide directed towards the C-terminal region of Human TELO2. Synthetic peptide located within the following region: LEDLMDELLEARSWLADVAEKDPDEDCRTLALRALLLLQRLKNRLLPPAS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 92 kDa |
Gene Name | telomere maintenance 2 |
Database Link | |
Background | This gene encodes a protein that functions as an S-phase checkpoint protein in the cell cycle. The protein may also play a role in DNA repair. |
Synonyms | CLK2; TEL2; YHFS |
Note | Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 92%; Dog: 85%; Bovine: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |