GCDH Rabbit Polyclonal Antibody
CNY 4628.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Rat |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Gcdh Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LQLGRLKDQDKATPEMVSLLKRNNCGKALDIARQARDILGGNGISDEYHV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 49 kDa |
Gene Name | glutaryl-CoA dehydrogenase |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | ACAD5; GCD |
Note | Immunogen sequence homology: Human: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 92%; Pig: 86%; Guinea pig: 85%; Zebrafish: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Fatty acid metabolism, Lysine degradation, Metabolic pathways, Tryptophan metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |