PMF1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PMF1 Antibody: synthetic peptide directed towards the middle region of human PMF1. Synthetic peptide located within the following region: TDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNAL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	19 kDa
Gene Name	polyamine-modulated factor 1
Database Link	NP_009152 Entrez Gene 11243 Human UniProt ID Q6P1K2
Background	PMF1 is part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. It may act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT.
Synonyms	Est1p-like protein B (EST1B); OTTHUMP00000016581; polyamine-modulated factor 1
Note	Immunogen sequence homology: Goat: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Families	Stem cell - Pluripotency

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.