ENTR1 Rabbit Polyclonal Antibody
CAT#: TA332028
Rabbit Polyclonal Anti-SDCCAG3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-SDCCAG3 Antibody is: synthetic peptide directed towards the C-terminal region of Human SDCCAG3. Synthetic peptide located within the following region: PAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSKLRRKLNEVQSFSE |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 39 kDa |
| Gene Name | serologically defined colon cancer antigen 3 |
| Database Link | |
| Background | SDCCAG3 may be involved in modulation of TNF response and may be involved in presentation of TNFRSF1A on the cell surface. |
| Synonyms | NY-CO-3 |
| Note | Immunogen sequence homology: Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
