POLR3G Rabbit Polyclonal Antibody
CAT#: TA332037
Rabbit Polyclonal Anti-POLR3G Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-POLR3G Antibody is: synthetic peptide directed towards the middle region of Human POLR3G. Synthetic peptide located within the following region: SKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTN |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 26 kDa |
Gene Name | polymerase (RNA) III subunit G |
Database Link | |
Background | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3G is a specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It may direct with other members of the RPC3/POLR3C-RPC6/POLR3F-RPC7/POLR3G subcomplex RNA Pol III binding to the TFIIIB-DNA complex via the interactions between TFIIIB and POLR3F. It may be involved either in the recruitment and stabilization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation. POLR3G plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. POLR3G acts as nuclear and cytosolic DNA sensor involved in innate immune response. POLR3G can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway. |
Synonyms | RPC7; RPC32 |
Note | Immunogen sequence homology: Human: 100% |
Reference Data | |
Protein Pathways | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |