PC6 (PCSK5) Rabbit Polyclonal Antibody
CAT#: TA332044
Rabbit Polyclonal Anti-PCSK5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5200.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-PCSK5 Antibody: synthetic peptide directed towards the middle region of human PCSK5. Synthetic peptide located within the following region: CAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDIS |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 89 kDa |
| Gene Name | proprotein convertase subtilisin/kexin type 5 |
| Database Link | |
| Background | PCSK5 belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. PCSK5 mediates posttranslational endoproteolytic processing for several integrin alpha subunits. It is thought to process prorenin, pro-membrane type-1 matrix metalloproteinase and HIV-1 glycoprotein gp160. Two alternatively spliced transcripts are described for this gene but only one has its full length nature known.The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein mediates posttranslational endoproteolytic processing for several integrin alpha subunits. It is thought to process prorenin, pro-membrane type-1 matrix metalloproteinase and HIV-1 glycoprotein gp160. Two alternatively spliced transcripts are described for this gene but only one has its full length nature known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Synonyms | PC5; PC6; PC6A; SPC6 |
| Note | Immunogen sequence homology: Dog: 100%; Human: 100%; Bovine: 100%; Horse: 93%; Rabbit: 93%; Mouse: 86%; Rat: 79% |
| Reference Data | |
| Protein Families | Druggable Genome, Protease, Secreted Protein |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
