Ccdc85a Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Ccdc85a Antibody is: synthetic peptide directed towards the middle region of Rat Ccdc85a. Synthetic peptide located within the following region: YSGMNESTLSYVRQLEARVRQLEEENRMLPQATQNRSQPPTRNSSNMEKG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	coiled-coil domain containing 85A
Database Link	NP_001178482 Entrez Gene 289855 Rat
Background	The function of this protein remains unknown.
Synonyms	KIAA1912
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Rat: 86%; Mouse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.