INTS1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-INTS1 Antibody is: synthetic peptide directed towards the N-terminal region of Human INTS1. Synthetic peptide located within the following region: TVRRPSAAAKPSGHPPPGDFIALGSKGQANESKTASTLLKPAPSGLPSER
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	240 kDa
Gene Name	integrator complex subunit 1
Database Link	NP_001073922 Entrez Gene 26173 Human UniProt ID Q8N201
Background	INTS1 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit and mediates 3-prime end processing of small nuclear RNAs U1 and U2 .
Synonyms	INT1; NET28
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Horse: 86%; Mouse: 86%; Bovine: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.