SLC38A8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC38A8 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC38A8. Synthetic peptide located within the following region: VSVLSLLACCLIYSLTGVYGFLTFGTEVSADVLMSYPGNDMVIIVARVLF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	solute carrier family 38 member 8
Database Link	NP_001073911 Entrez Gene 146167 Human UniProt ID A6NNN8
Background	SLC38A8 is a putative sodium-dependent amino acid/proton antiporter.
Synonyms	FVH2
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Pig: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.