YARS2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-YARS2 Antibody is: synthetic peptide directed towards the C-terminal region of Human YARS2. Synthetic peptide located within the following region: QPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	tyrosyl-tRNA synthetase 2
Database Link	NP_001035526 Entrez Gene 51067 Human UniProt ID Q9Y2Z4
Background	This gene encodes a mitochondrial protein that catalyzes the attachment of tyrosine to tRNA(Tyr). Mutations in this gene are associated with myopathy with lactic acidosis and sideroblastic anemia type 2 (MLASA2).
Synonyms	CGI-04; MLASA2; MT-TYRRS; TYRRS
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Bovine: 93%; Dog: 86%; Rat: 86%; Guinea pig: 86%; Horse: 85%; Mouse: 79%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Aminoacyl-tRNA biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.