MTTP Rabbit Polyclonal Antibody
CNY 4628.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Mouse |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-MTTP Antibody is: synthetic peptide directed towards the C-terminal region of MOUSE MTTP. Synthetic peptide located within the following region: QVVIEAQGLEALIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSD |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 98 kDa |
| Gene Name | microsomal triglyceride transfer protein |
| Database Link | |
| Background | MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia. |
| Synonyms | ABL; MTP |
| Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
