STIMATE Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TMEM110 Antibody: synthetic peptide directed towards the N terminal of human TMEM110. Synthetic peptide located within the following region: MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	transmembrane protein 110
Database Link	NP_940965 Entrez Gene 375346 Human UniProt ID Q86TL2
Background	The function of this protein remains unknown.
Synonyms	DKFZp667E1121; DKFZp779M0254; FLJ37613; FLJ42395; MGC52022
Note	Immunogen sequence homology: Human: 100%; Rabbit: 100%; Rat: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.