TPRG1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM79B Antibody: synthetic peptide directed towards the N terminal of human FAM79B. Synthetic peptide located within the following region: DPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	tumor protein p63 regulated 1
Database Link	NP_940887 Entrez Gene 285386 Human UniProt ID Q6ZUI0
Background	The specific function of this protein remains unknown.
Synonyms	FAM79B
Note	Immunogen sequence homology: Human: 100%; Dog: 92%; Rat: 92%; Pig: 86%; Horse: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.