MAMSTR Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FLJ36070 Antibody: synthetic peptide directed towards the N terminal of human FLJ36070. Synthetic peptide located within the following region: QPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQQLRLR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	MEF2 activating motif and SAP domain containing transcriptional regulator
Database Link	NP_872380 Entrez Gene 284358 Human UniProt ID Q6ZN01
Background	FLJ36070 is a transcriptional coactivator.FLJ36070 stimulates the transcriptional activity of MEF2C. FLJ36070 stimulates MYOD1 activity in part via MEF2, resulting in an enhancement of skeletal muscle differentiation.
Synonyms	MASTR
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.