WDR21A (DCAF4) Rabbit Polyclonal Antibody
CAT#: TA333413
Rabbit Polyclonal Anti-DCAF4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB, IP, IF |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-DCAF4 Antibody: synthetic peptide directed towards the middle region of human DCAF4. Synthetic peptide located within the following region: GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 43 kDa |
Gene Name | DDB1 and CUL4 associated factor 4 |
Database Link | |
Background | DCAF4 is a WD repeat-containing protein. The function of DCAF4 remains unknown.This gene encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. |
Synonyms | WDR21; WDR21A |
Note | Immunogen sequence homology: Pig: 100%; Human: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Rat: 86%; Bovine: 86%; Guinea pig: 86%; Mouse: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |