ILDR1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ILDR1 Antibody: synthetic peptide directed towards the middle region of human ILDR1. Synthetic peptide located within the following region: RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	immunoglobulin like domain containing receptor 1
Database Link	NP_787120 Entrez Gene 286676 Human UniProt ID Q86SU0
Background	ILDR1 is a putative membrane receptor.
Synonyms	DFNB42; ILDR1alpha; ILDR1alpha'; ILDR1beta
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Horse: 86%; Mouse: 86%; Rat: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.