SLC43A2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC43A2 Antibody: synthetic peptide directed towards the N terminal of human SLC43A2. Synthetic peptide located within the following region: TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	solute carrier family 43 member 2
Database Link	NP_689559 Entrez Gene 124935 Human UniProt ID Q8N370
Background	SLC43A2 is a Sodium-, chloride, pH-independent high affinity transport of large neutral amino acids.
Synonyms	LAT4
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 86%; Rat: 86%; Horse: 85%; Bovine: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.