ZNF23 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF23 Antibody: synthetic peptide directed towards the N terminal of human ZNF23. Synthetic peptide located within the following region: MLENYGNVASLGFPLLKPAVISQLEGGSELGGSSPLAAGTGLQGLQTDIQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	73 kDa
Gene Name	zinc finger protein 23
Database Link	NP_666016 Entrez Gene 7571 Human UniProt ID P17027
Background	ZNF23 (GZF1) has a BTB/POZ (broad complex, tramtrack, and bric-a-brac)/(poxvirus and zinc finger) domain and 10 tandemly repeated zinc finger motifs with strong transcriptional repressive activity.
Synonyms	KOX16; Zfp612; ZNF359; ZNF612
Note	Immunogen sequence homology: Human: 100%; Dog: 86%; Rat: 86%; Mouse: 86%; Pig: 79%; Horse: 79%; Bovine: 79%; Guinea pig: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.