C6ORF199 (AK9) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-AK9 Antibody: synthetic peptide directed towards the N terminal of human AK9. Synthetic peptide located within the following region: TSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYIT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	adenylate kinase 9
Database Link	NP_659462 Entrez Gene 221264 Human UniProt ID Q5TCS8
Background	The function of the AK9 protein remains unknown.
Synonyms	AK 9; AKD1; AKD2; C6orf199; C6orf224; dJ70A9.1
Note	Immunogen sequence homology: Human: 100%; Pig: 92%; Rat: 86%; Rabbit: 86%; Guinea pig: 83%; Dog: 82%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.