C6orf72 (GINM1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GINM1 Antibody is: synthetic peptide directed towards the middle region of Human GINM1. Synthetic peptide located within the following region: SVRILVHEWPMTSGSSLQLIVIQEEVVEIDGKQVQQKDVTEIDILVKNRG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	glycoprotein integral membrane 1
Database Link	NP_620140 Entrez Gene 116254 Human UniProt ID Q9NU53
Background	The function of this protein remains unknown.
Synonyms	C6orf72; dJ12G14.2
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Pig: 86%; Guinea pig: 86%; Mouse: 79%; Rabbit: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.