AGAP8 (AGAP4) Rabbit Polyclonal Antibody
CAT#: TA333550
Rabbit Polyclonal Anti-AGAP4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-AGAP4 Antibody is: synthetic peptide directed towards the C-terminal region of Human AGAP4. Synthetic peptide located within the following region: WPVELRKVMSSIGNDLANSIWEGSSQGQTKPSEKSTREEKERWIRSKYEE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 73 kDa |
Gene Name | ArfGAP with GTPase domain, ankyrin repeat and PH domain 4 |
Database Link | |
Background | AGAP4 is a putative GTPase-activating protein. |
Synonyms | AGAP-4; AGAP-8; AGAP8; CTGLF1; CTGLF5; MRIP2 |
Note | Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Guinea pig: 86%; Rabbit: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |