Progestin Receptor Beta (PAQR8) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PAQR8 Antibody is: synthetic peptide directed towards the C-terminal region of Human PAQR8. Synthetic peptide located within the following region: QGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	progestin and adipoQ receptor family member 8
Database Link	NP_588608 Entrez Gene 85315 Human UniProt ID Q8TEZ7
Background	PAQR8 is a steroid membrane receptor. It binds progesterone and may be involved in oocyte maturation.
Synonyms	C6orf33; LMPB1; MPRB
Note	Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Guinea pig: 93%; Rabbit: 92%; Rat: 86%; Mouse: 86%; Bovine: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.