COA8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-APOPT1 Antibody is: synthetic peptide directed towards the C-terminal region of Human APOPT1. Synthetic peptide located within the following region: KEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	apoptogenic 1, mitochondrial
Database Link	NP_115750 Entrez Gene 84334 Human UniProt ID Q96IL0
Background	APOPT1 plays a role in the regulation of apoptosis. It mediates mitochondria-induced cell death in vascular smooth muscle cells through the release of cytochrome c from mitochondria, followed by the activation of the caspase cascade.
Synonyms	APOP; APOP1; C14orf153
Note	Immunogen sequence homology: Human: 100%; Horse: 82%; Bovine: 82%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.