FOXL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FOXL2 Antibody: synthetic peptide directed towards the N terminal of human FOXL2. Synthetic peptide located within the following region: MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGGGGGGGTAPEKPD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	forkhead box L2
Database Link	NP_075555 Entrez Gene 668 Human UniProt ID P58012
Background	FOXL2 is a member of the forkhead family. The forkhead domain is a monomeric DNA binding motif that defines a rapidly growing family of eukaryotic transcriptional regulators. Genetic and biochemical data suggest a central role in embryonic development for forkhead proteins.
Synonyms	BPES; BPES1; PFRK; PINTO; POF3
Note	Immunogen sequence homology: Dog: 100%; Human: 100%; Pig: 100%; Goat: 92%; Rabbit: 92%; Bovine: 84%; Mouse: 84%; Rat: 84%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.