C1orf149 (MEAF6) Rabbit Polyclonal Antibody

CAT#: TA333700

Rabbit Polyclonal Anti-FLJ11730 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of MYST/Esa1-associated factor 6 (MEAF6)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human chromosome 1 open reading frame 149 (C1orf149), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human chromosome 1 open reading frame 149 (C1orf149), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-FLJ11730 Antibody: synthetic peptide directed towards the N terminal of human FLJ11730. Synthetic peptide located within the following region: HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 23 kDa
Gene Name MYST/Esa1 associated factor 6
Background The screening of cDNA expression libraries from human tumors with serum antibody (SEREX) has proven to be a powerful method for identifying the repertoire of tumor antigens recognized by the immune system of cancer patients, referred to as the cancer immunome. In this regard, cancer/testis (CT) antigens are of particular interest because of their immunogenicity and restricted expression patterns. Synoivial sarcomas are striking with regard to CT antigen expression, however, highly expressed in sarcoma, CT antigens do not induce frequent humoral immune responses in sarcoma patients. Sera from two patients were used to immunoscreen cDNA libraries from two synovial sarcoma cell lines and normal testis, resulting in the identification of 113 distinct antigens. Sarcoma antigen NY-SAR-91 is one of them.
Synonyms C1orf149; CENP-28; EAF6; NY-SAR-91
Note Immunogen sequence homology: Bovine:100%; Western clawed frog:100%; Chicken:100%; African clawed frog:100%; Green puffer:100%; Zebra finch:100%; Mouse:100%; Human:100%; Rat:100%; Zebrafish:92%; Atlantic salmon:92%; Rainbow smelt:85%; Filarial nematode wor
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...