BIGM103 (SLC39A8) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human, Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC39A8 Antibody: synthetic peptide directed towards the N terminal of human SLC39A8. Synthetic peptide located within the following region: QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	solute carrier family 39 member 8
Database Link	NP_071437 Entrez Gene 64116 Human UniProt ID Q9C0K1
Background	This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import
Synonyms	BIGM103; CDG2N; LZT-Hs6; PP3105; ZIP8
Note	Immunogen sequence homology: Human: 100%; Pig: 85%; Dog: 79%; Horse: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.