ANKLE2 Rabbit Polyclonal Antibody
CAT#: TA333847
Rabbit Polyclonal Anti-ANKLE2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-ANKLE2 Antibody: synthetic peptide directed towards the middle region of human ANKLE2. Synthetic peptide located within the following region: CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 104 kDa |
| Gene Name | ankyrin repeat and LEM domain containing 2 |
| Database Link | |
| Background | ANKLE2 is a single-pass membrane protein. It contains 1 ANK repeat and 1 LEM domain. It contains 1 RING-type zinc finger. The function of ANKLE2 remains unknown. |
| Synonyms | KIAA0692; Lem4; LEMD7; MCPH16 |
| Note | Immunogen sequence homology: Human: 100% |
| Reference Data | |
| Protein Families | Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
