WHSC1 Rabbit Polyclonal Antibody
CAT#: TA333862
Rabbit Polyclonal Anti-WHSC1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-WHSC1 Antibody: synthetic peptide directed towards the N terminal of human WHSC1. Synthetic peptide located within the following region: KYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 88 kDa |
Gene Name | Wolf-Hirschhorn syndrome candidate 1 |
Database Link | |
Background | WHSC1 encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. |
Synonyms | FLJ23286; KIAA1090; MMSET; NSD2; REIIBP; TRX5 |
Note | Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 88%; Guinea pig: 88%; Rat: 86%; Mouse: 86%; Rabbit: 76% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Lysine degradation |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |