SLC5A4 Rabbit Polyclonal Antibody
CAT#: TA333874
Rabbit Polyclonal Anti-SLC5A4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-SLC5A4 Antibody: synthetic peptide directed towards the middle region of human SLC5A4. Synthetic peptide located within the following region: LLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRV |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 72 kDa |
| Gene Name | solute carrier family 5 member 4 |
| Database Link | |
| Background | SLC5A4 belongs to the sodium:solute symporter family and is a sodium-dependent glucose transporter. |
| Synonyms | DJ90G24.4; SAAT1; SGLT3 |
| Note | Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Guinea pig: 86%; Mouse: 79%; Bovine: 79% |
| Reference Data | |
| Protein Families | Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
