Tuft1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Tuft1 Antibody is: synthetic peptide directed towards the middle region of Mouse Tuft1. Synthetic peptide located within the following region: LSRYQREAEQSNVALQREEDRVEQKAAEIEELQRRLLGMEAEHQALLVKV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	tuftelin 1
Database Link	NP_035786 Entrez Gene 22156 Mouse UniProt ID O08970
Background	Tuft1 is involved in the mineralization and structural organization of enamel.
Synonyms	TUFT1
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Guinea pig: 92%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Dog: 79%; Zebrafish: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.