PDI (PDIA2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PDIA2 Antibody is: synthetic peptide directed towards the N-terminal region of Human PDIA2. Synthetic peptide located within the following region: EFGVTEYPTLKFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLED
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	protein disulfide isomerase family A member 2
Database Link	NP_006840 Entrez Gene 64714 Human UniProt ID Q13087
Background	Protein disulfide isomerases, such as PDIP, are endoplasmic reticulum (ER) resident proteins that catalyze protein folding and thiol-disulfide interchange reactions.
Synonyms	PDA2; PDI; PDIP; PDIR
Note	Immunogen sequence homology: Human: 100%; Bovine: 100%; Pig: 93%; Dog: 92%; Horse: 86%; Guinea pig: 86%; Rat: 85%; Mouse: 85%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.