SLC35B1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC35B1 Antibody: synthetic peptide directed towards the C terminal of human SLC35B1. Synthetic peptide located within the following region: ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	solute carrier family 35 member B1
Database Link	NP_005818 Entrez Gene 10237 Human UniProt ID P78383
Background	SLC35B1 belongs to the nucleotide-sugar transporter family and it is probable sugar transporter.
Synonyms	UGTREL1
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.