SLC7A4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SLC7A4 Antibody: synthetic peptide directed towards the middle region of human SLC7A4. Synthetic peptide located within the following region: GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFIVAAGSICAMN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	68 kDa
Gene Name	solute carrier family 7 member 4
Database Link	NP_004164 Entrez Gene 6545 Human UniProt ID O43246
Background	SLC7A4 is involved in the transport of the cationic amino acids (arginine, lysine and ornithine).
Synonyms	CAT-4; CAT4; HCAT3; VH
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 86%; Dog: 85%; Zebrafish: 75%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.