SLC7A7 Rabbit Polyclonal Antibody

CAT#: TA333985

Rabbit Polyclonal Anti-SLC7A7 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Transient overexpression lysate of solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 (SLC7A7), transcript variant 2
    • 100 ug

CNY 3080.00


Transient overexpression lysate of solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 (SLC7A7), transcript variant 1
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-SLC7A7 Antibody: synthetic peptide directed towards the middle region of human SLC7A7. Synthetic peptide located within the following region: WGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDI
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 56 kDa
Gene Name solute carrier family 7 member 7
Background The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene.
Synonyms LAT3; LPI; MOP-2; y+LAT-1; Y+LAT1
Note Immunogen sequence homology: Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Dog: 86%; Rat: 79%; Mouse: 79%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...