MCT2 (SLC16A7) Rabbit Polyclonal Antibody
CAT#: TA334064
Rabbit Polyclonal Anti-SLC16A7 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SLC16A7 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC16A7. Synthetic peptide located within the following region: LAGKLVDLTGEYKYMYMSCGAIVVAASVWLLIGNAINYRLLAKERKEENA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | solute carrier family 16 member 7 |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | MCT2 |
Note | Immunogen sequence homology: Human: 100%; Dog: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 85%; Pig: 79%; Rat: 79%; Zebrafish: 79%; Guinea pig: 75% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |