IYD Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-IYD Antibody is: synthetic peptide directed towards the N-terminal region of Human IYD. Synthetic peptide located within the following region: NADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENV |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 27 kDa |
| Gene Name | iodotyrosine deiodinase |
| Database Link | |
| Background | This gene encodes an enzyme that catalyzes the oxidative NADPH-dependent deiodination of mono- and diiodotyrosine, which are the halogenated byproducts of thyroid hormone production. The N-terminus of the protein functions as a membrane anchor. Mutations in this gene cause congenital hypothyroidism due to dyshormonogenesis type 4, which is also referred to as deiodinase deficiency, or iodotyrosine dehalogenase deficiency, or thyroid hormonogenesis type 4. |
| Synonyms | C6orf71; DEHAL1; IYD-1; TDH4 |
| Note | Immunogen sequence homology: Human: 100%; Rat: 86%; Dog: 79%; Rabbit: 79%; Bovine: 77% |
| Reference Data | |
| Protein Families | Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
