Tspan33 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Tspan33 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: NTMCGQGMQALDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	tetraspanin 33
Database Link	NP_001102697 Entrez Gene 500065 Rat
Background	The function of this protein remains unknown.
Synonyms	hPen; MGC50844; PEN; penumbra; Tspan-33
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Pig: 86%; Horse: 86%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.