ACYP1 Rabbit Polyclonal Antibody
CAT#: TA334096
Rabbit Polyclonal Anti-ACYP1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ACYP1 Antibody is: synthetic peptide directed towards the middle region of Human ACYP1. Synthetic peptide located within the following region: LVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEK |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 11 kDa |
Gene Name | acylphosphatase 1 |
Database Link | |
Background | Acylphosphatase is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase, on the basis of their tissue localization. This gene encodes the erythrocyte acylphosphatase isoenzyme. Alternatively spliced transcript variants that encode different proteins were identified through data analysis. |
Synonyms | ACYPE |
Note | Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 85% |
Reference Data | |
Protein Pathways | Pyruvate metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |