Tns3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Tns3 Antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Tns3. Synthetic peptide located within the following region: FLTVSPGASSHHSPGLQNQNVSLPGQPPLPEKKRASEGDRSLGSVSPSSS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	tensin 3
Database Link	NP_001077056 Entrez Gene 319939 Mouse UniProt ID Q5SSZ5
Background	Tns3 may play a role in actin remodeling. Involved in the dissociation of the integrin-tensin-actin complex. EGF activates TNS4 and down-regulates TNS3 which results in capping the tail of ITGB1. It seems to be involved in mammary cell migration. Tns3 may be involved in cell migration and bone development.
Synonyms	DKFZp686K12123; DKFZp686M1045; FLJ13732; FLJ35545; H_NH049I23.2; H_NH0549I23.2; MGC88434; OTTHUMP00000082709; TEM6; TENS1; TPP
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.