PNLIPRP3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PNLIPRP3 Antibody is: synthetic peptide directed towards the C-terminal region of Human PNLIPRP3. Synthetic peptide located within the following region: IVSGKLEPGMTYTKLIDADVNVGNITSVQFIWKKHLFEDSQNKLGAEMVI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	pancreatic lipase related protein 3
Database Link	NP_001011709 Entrez Gene 119548 Human UniProt ID Q17RR3
Background	The function of this protein remains unknown.
Synonyms	OTTHUMP00000020563; pancreatic lipase-related protein 3
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.