SLC7A2 Rabbit Polyclonal Antibody

CAT#: TA334148

Rabbit Polyclonal Anti-SLC7A2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 (SLC7A2), transcript variant 2
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Purified recombinant protein of Homo sapiens solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 (SLC7A2), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Purified recombinant protein of Homo sapiens solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 (SLC7A2), transcript variant 2, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-SLC7A2 Antibody: synthetic peptide directed towards the middle region of human SLC7A2. Synthetic peptide located within the following region: VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 72 kDa
Gene Name solute carrier family 7 member 2
Background SLC7A2 is a low-affinity, high capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine). SLC7A2 plays a regulatory role in classical or alternative activation of macrophages.
Synonyms ATRC2; CAT2; HCAT2
Note Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%
Reference Data
Protein Families Druggable Genome, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...