HPS2 (AP3B1) Rabbit Polyclonal Antibody
CAT#: TA334212
Rabbit Polyclonal Anti-Ap3b1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Rat |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Ap3b1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 121 kDa |
Gene Name | adaptor related protein complex 3 beta 1 subunit |
Database Link | |
Background | The function of Ap3b1 remains unknown. |
Synonyms | ADTB3; ADTB3A; HPS; HPS2; PE |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Mouse: 92%; Dog: 79% |
Reference Data | |
Protein Pathways | Lysosome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |